PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vradi0070s00230.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB_related
Protein Properties Length: 257aa    MW: 28500.3 Da    PI: 5.6497
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vradi0070s00230.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.81.2e-13108148445
                        S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        W ++E+ ll++a++++G g+W+ +a+++g +++  qc+++++
  Vradi0070s00230.1 108 WNADEEILLLEAIEMYGFGNWNEVAEYVG-TKSKSQCIDHYN 148
                        *****************************.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM002911.0E-104489IPR000433Zinc finger, ZZ-type
SuperFamilySSF578509.18E-1648111No hitNo description
CDDcd023353.33E-254896No hitNo description
PROSITE profilePS5013510.6894891IPR000433Zinc finger, ZZ-type
PfamPF005696.9E-104888IPR000433Zinc finger, ZZ-type
PROSITE patternPS0135705077IPR000433Zinc finger, ZZ-type
SuperFamilySSF466891.05E-13100154IPR009057Homeodomain-like
PROSITE profilePS5129321.97103155IPR017884SANT domain
SMARTSM007173.4E-12104153IPR001005SANT/Myb domain
PfamPF002491.0E-13107148IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-9108149IPR009057Homeodomain-like
CDDcd001671.28E-13108148No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MGRCRAASVT GPADDDPNHR LKRKRAASEN SETLATVQGI ANSKVSLYHC NYCNKDISGR  60
IRIKCAVCQD FDLCIECFSV GAEVTPHKSN HPYRVMDNLS FPLICPDWNA DEEILLLEAI  120
EMYGFGNWNE VAEYVGTKSK SQCIDHYNAV YMNSPCFPLP DLSHVMGKGR DELFAMVKGH  180
EAKKEFSLTA ELMLKEEAPF SDVLSYEETK EAEIKNIEIS RLTSACGKSC SSTLKKTSNL  240
SQSKEVKVEG MFSDAV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150384e-82AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014523682.10.0PREDICTED: transcriptional adapter ADA2b-like isoform X2
SwissprotQ75LL62e-92TADA2_ORYSJ; Transcriptional adapter ADA2
TrEMBLA0A0L9T7U21e-179A0A0L9T7U2_PHAAN; Uncharacterized protein
STRINGGLYMA13G11200.21e-146(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15371726